Results of Search:

Program: fasta3
Database: swall
Title: Sequence
SeqLen: 319
Matrix: blosum50
Ktup: 2
GapPenOpen:-12
GapPenExtend:-2

FASTA searches a protein or DNA sequence data bank

 version 3.0t82 November 1, 1997
Please cite:
 W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448

/data/web/home/tmp/20116890058014.fasta3: 319 aa
 >/data/web/home/tmp/20116890058014.fasta3.res.a  [Unknown form], 319 bases, 53D304EE checksum.
 vs  SWISS-PROT All library
searching /data/fastafiles/swall library

75633374 residues in 242566 sequences
 statistics extrapolated from 50000 to 242299 sequences
 Expectation_n fit: rho(ln(x))= 5.8338+/-0.000528; mu= 3.0256+/- 0.030;
 mean_var=70.7492+/-13.881, Z-trim: 46  B-trim: 3152 in 1/63

FASTA (3.08 July, 1997) function (optimized, /ebi/services/pkgs/blast/matrix/aa/blosu matrix) ktup: 2
 join: 37, opt: 25, gap-pen: -12/ -2, width:  16 reg.-scaled
 Scan time: 36.370
The best scores are:                             initn init1 opt z-sc E(242299)
SWALL:RIR4_SALTY P17424 RIBONUCLEOSIDE-D  ( 319) 2091 2091 2091 2492.4 1.2e-131
SWALL:RIR4_ECOLI P37146 RIBONUCLEOSIDE-D  ( 319) 1877 1877 1877 2238.0 1.8e-117
SWALL:E1237794 E1237794 RIBONUCLEOTIDE R  ( 324) 1531 1531 1554 1853.8 4.6e-96
SWALL:Q50549 Q50549 RIBONUCLEOTIDE REDUC  ( 324) 1531 1531 1554 1853.8 4.6e-96
SWALL:RIR2_MYCTU Q10840 RIBONUCLEOSIDE-D  ( 322) 1382 1382 1402 1673.2 5.3e-86
SWALL:Q50548 Q50548 RIBONUCLEOTIDE REDUC  ( 321) 1333  683 1373 1638.7 4.4e-84
SWALL:RIR2_MYCPN P75461 RIBONUCLEOSIDE-D  ( 339) 1096 1096 1112 1328.0 8.8e-67
SWALL:RIR2_MYCGE P47471 RIBONUCLEOSIDE-D  ( 340) 1105 1105 1111 1326.8 1e-66
SWALL:RIR2_BACSU P50621 RIBONUCLEOSIDE-D  ( 329)  764  423  868 1038.2 1.2e-50
SWALL:O30601 O30601 YOJQ/S. 1/98          ( 329)  742  411  837 1001.3 1.4e-48
SWALL:E1185476 E1185476 YOSP PROTEIN. 1/  ( 195)  467  213  493 596.0 5.3e-26
SWALL:P74732 P74732 HYPOTHETICAL 41.6 KD  ( 355)  215  102  306 369.5 2.2e-13
SWALL:RIR2_HELPY P55983 RIBONUCLEOSIDE-D  ( 341)  118  118  246 298.4 2e-09
SWALL:RIR2_VZVD P09247 RIBONUCLEOSIDE-DI  ( 306)  130   47  225 274.2 4.4e-08
SWALL:RIR2_TOBAC P49730 RIBONUCLEOSIDE-D  ( 329)  183  117  223 271.3 6.4e-08
SWALL:RIR2_ARATH P50651 RIBONUCLEOSIDE-D  ( 340)   42   42  207 252.1 7.6e-07
SWALL:RIR2_MESAU Q60561 RIBONUCLEOSIDE-D  ( 386)   95   95  207 251.2 8.5e-07
SWALL:P79733 P79733 RIBONUCLEOTIDE REDUC  ( 386)   99   99  201 244.1 2.1e-06
SWALL:RIR2_HUMAN P31350 RIBONUCLEOSIDE-D  ( 389)   95   95  198 240.4 3.4e-06
SWALL:G2828563 G2828563 RIBONUCLEOTIDE R  ( 345)   41   41  196 238.9 4.1e-06
SWALL:RIR2_MOUSE P11157 RIBONUCLEOSIDE-D  ( 390)   95   95  195 236.9 5.3e-06
SWALL:RIR2_DICDI P42521 RIBONUCLEOSIDE-D  ( 338)   44   44  193 235.5 6.4e-06
SWALL:RIR2_HSVBC Q01319 RIBONUCLEOSIDE-D  ( 314)   90   56  192 234.8 6.9e-06
SWALL:RIR2_CAEEL P42170 PROBABLE RIBONUC  ( 381)  107   72  189 229.9 1.3e-05
SWALL:Q98526 Q98526 RIBONUCLEOTIDE REDUC  ( 324)   56   56  186 227.4 1.8e-05
SWALL:RIR2_HSVSA Q01038 RIBONUCLEOSIDE-D  ( 305)  113   83  183 224.3 2.7e-05
SWALL:RIR2_SCHPO P36603 RIBONUCLEOSIDE-D  ( 391)   41   41  182 221.4 3.9e-05
SWALL:RIR2_YEAST P09938 RIBONUCLEOSIDE-D  ( 399)   54   54  182 221.2 3.9e-05
SWALL:P88951 P88951 ORF 60. 3/98          ( 305)   39   39  177 217.2 6.6e-05
SWALL:RIR2_SPISO P07201 RIBONUCLEOSIDE-D  ( 384)  103  103  178 216.8 7e-05
SWALL:P88997 P88997 RIBONUCLEOTIDE REDUC  ( 305)   63   63  175 214.8 9e-05
SWALL:Q27124 Q27124 RIBONULEOTIDE REDUCT  ( 399)  110  110  175 212.9 0.00011
SWALL:RIR2_SALTY P37427 RIBONUCLEOSIDE-D  ( 375)  261  150  174 212.2 0.00013
SWALL:RIR2_ECOLI P00453 RIBONUCLEOSIDE-D  ( 375)  259  150  167 203.8 0.00037
SWALL:RIR2_VACCV P11158 RIBONUCLEOSIDE-D  ( 319)   55   55  164 201.4 0.0005
SWALL:G2772676 G2772676 RIBONUCLEOTIDE R  ( 319)   56   56  164 201.4 0.0005
SWALL:RIR2_HSVE4 P50644 RIBONUCLEOSIDE-D  ( 320)   55   55  164 201.4 0.0005
SWALL:RIR2_PLAF4 P50650 RIBONUCLEOSIDE-D  ( 349)   87   60  164 200.8 0.00054
SWALL:RIR2_VACCC P20493 RIBONUCLEOSIDE-D  ( 319)   55   55  162 199.0 0.00068
SWALL:O39262 O39262 COUNTERPART OF HSV-1  ( 320)   55   55  162 199.0 0.00068
SWALL:G544843 G544843 C8L PRODUCT. 3/98   ( 333)   59   59  162 198.7 0.00071
SWALL:RIR2_VACCP P29883 RIBONUCLEOSIDE-D  ( 319)   56   56  159 195.4 0.0011
SWALL:RIR2_VARV P33799 RIBONUCLEOSIDE-DI  ( 319)   56   56  159 195.4 0.0011
SWALL:Q89087 Q89087 GARCIA-1966 LEFT NEA  ( 319)   56   56  159 195.4 0.0011
SWALL:Q89559 Q89559 SOMALIA-1977 LEFT VA  ( 319)   56   56  159 195.4 0.0011
SWALL:RIR2_PRVKA P50645 RIBONUCLEOSIDE-D  ( 303)   73   45  158 194.6 0.0012
SWALL:P87632 P87632 41KBP FRAGMENT FROM   ( 319)   56   56  158 194.3 0.0013
SWALL:RIR2_HAEIN P43755 RIBONUCLEOSIDE-D  ( 375)  210  145  157 192.0 0.0017
SWALL:RIR2_ASFB7 P42492 RIBONUCLEOSIDE-D  ( 334)   36   36  155 190.4 0.0021
SWALL:Q96211 Q96211 RIBONUCLEOTIDE REDUC  ( 379)  134  134  153 187.1 0.0031

>>SWALL:RIR4_SALTY P17424 RIBONUCLEOSIDE-DIPHOSPHATE RED  (319 aa)
 initn: 2091 init1: 2091 opt: 2091 Z-score: 2492.4 expect() 1.2e-131
Smith-Waterman score: 2091;  100.000% identity in 319 aa overlap

               10        20        30        40        50        60
/data/ MKLSRISAINWNKIQDDKDLEVWNRLTSNFWLPEKVPLSNDIPAWQTLSAAEQQLTIRVF
       ::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::
SWALL: MKLSRISAINWNKIQDDKDLEVWNRLTSNFWLPEKVPLSNDIPAWQTLSAAEQQLTIRVF
               10        20        30        40        50        60

               70        80        90       100       110       120
/data/ TGLTLLDTIQNIAGAPSLMADAITPHEEAVLSNISFMEAVHARSYSSIFSTLCQTKEVDA
       ::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::
SWALL: TGLTLLDTIQNIAGAPSLMADAITPHEEAVLSNISFMEAVHARSYSSIFSTLCQTKEVDA
               70        80        90       100       110       120

              130       140       150       160       170       180
/data/ AYAWSEENPPLQRKAQIILAHYVSDEPLKKKIASVFLESFLFYSGFWLPMYFSSRGKLTN
       ::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::
SWALL: AYAWSEENPPLQRKAQIILAHYVSDEPLKKKIASVFLESFLFYSGFWLPMYFSSRGKLTN
              130       140       150       160       170       180

              190       200       210       220       230       240
/data/ TADLIRLIIRDEAVHGYYIGYKYQIALQKLSAIEREELKLFALDLLMELYDNEIRYTEAL
       ::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::
SWALL: TADLIRLIIRDEAVHGYYIGYKYQIALQKLSAIEREELKLFALDLLMELYDNEIRYTEAL
              190       200       210       220       230       240

              250       260       270       280       290       300
/data/ YAETGWVNDVKAFLCYNANKALMNLGYEALFPPEMADVNPAILAALSPNADENHDFFSGS
       ::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::
SWALL: YAETGWVNDVKAFLCYNANKALMNLGYEALFPPEMADVNPAILAALSPNADENHDFFSGS
              250       260       270       280       290       300

              310         
/data/ GSSYVMGKTVETEDEDWNF
       :::::::::::::::::::
SWALL: GSSYVMGKTVETEDEDWNF
              310         

>>SWALL:RIR4_ECOLI P37146 RIBONUCLEOSIDE-DIPHOSPHATE RED  (319 aa)
 initn: 1877 init1: 1877 opt: 1877 Z-score: 2238.0 expect() 1.8e-117
Smith-Waterman score: 1877;  87.774% identity in 319 aa overlap

               10        20        30        40        50        60
/data/ MKLSRISAINWNKIQDDKDLEVWNRLTSNFWLPEKVPLSNDIPAWQTLSAAEQQLTIRVF
       ::::::::::::::.:::::::::::::::::::::::::::::::::...:::::.:::
SWALL: MKLSRISAINWNKISDDKDLEVWNRLTSNFWLPEKVPLSNDIPAWQTLTVVEQQLTMRVF
               10        20        30        40        50        60

               70        80        90       100       110       120
/data/ TGLTLLDTIQNIAGAPSLMADAITPHEEAVLSNISFMEAVHARSYSSIFSTLCQTKEVDA
       ::::::::.::. :::::: ::.:::::::::::::::::::::::::::::::::.:::
SWALL: TGLTLLDTLQNVIGAPSLMPDALTPHEEAVLSNISFMEAVHARSYSSIFSTLCQTKDVDA
               70        80        90       100       110       120

              130       140       150       160       170       180
/data/ AYAWSEENPPLQRKAQIILAHYVSDEPLKKKIASVFLESFLFYSGFWLPMYFSSRGKLTN
       :::::::: :::::::::  :: .:.::::::::::::::::::::::::::::::::::
SWALL: AYAWSEENAPLQRKAQIIQQHYRGDDPLKKKIASVFLESFLFYSGFWLPMYFSSRGKLTN
              130       140       150       160       170       180

              190       200       210       220       230       240
/data/ TADLIRLIIRDEAVHGYYIGYKYQIALQKLSAIEREELKLFALDLLMELYDNEIRYTEAL
       ::::::::::::::::::::::::  ..:.:  .::::: ::.:::.::::::..::. :
SWALL: TADLIRLIIRDEAVHGYYIGYKYQKNMEKISLGQREELKSFAFDLLLELYDNELQYTDEL
              190       200       210       220       230       240

              250       260       270       280       290       300
/data/ YAETGWVNDVKAFLCYNANKALMNLGYEALFPPEMADVNPAILAALSPNADENHDFFSGS
       :::: :..:::::::::::::::::::: ::: :::.:::::::::::::::::::::::
SWALL: YAETPWADDVKAFLCYNANKALMNLGYEPLFPAEMAEVNPAILAALSPNADENHDFFSGS
              250       260       270       280       290       300

              310         
/data/ GSSYVMGKTVETEDEDWNF
       ::::::::.::::::::::
SWALL: GSSYVMGKAVETEDEDWNF
              310         

>>SWALL:E1237794 E1237794 RIBONUCLEOTIDE REDUCTASE SMALL  (324 aa)
 initn: 1531 init1: 1531 opt: 1554 Z-score: 1853.8 expect() 4.6e-96
Smith-Waterman score: 1554;  71.924% identity in 317 aa overlap

                    10        20        30        40        50     
/data/      MKLSRISAINWNKIQDDKDLEVWNRLTSNFWLPEKVPLSNDIPAWQTLSAAEQQL
              ..:.::::::..::.:: :::.:::.:::::::::.:::::.: ::.:.:.::
SWALL: MTGNAKLIDRVSAINWNRLQDEKDAEVWDRLTGNFWLPEKVPVSNDIPSWGTLTAGEKQL
               10        20        30        40        50        60

          60        70        80        90       100       110     
/data/ TIRVFTGLTLLDTIQNIAGAPSLMADAITPHEEAVLSNISFMEAVHARSYSSIFSTLCQT
       :.:::::::.:::::. .:: ::. ::.::::::::.::.:::.:::.:::.::::::.:
SWALL: TMRVFTGLTMLDTIQGTVGAVSLIPDALTPHEEAVLTNIAFMESVHAKSYSQIFSTLCST
               70        80        90       100       110       120

         120       130       140       150       160       170     
/data/ KEVDAAYAWSEENPPLQRKAQIILAHYVSDEPLKKKIASVFLESFLFYSGFWLPMYFSSR
        :.: :. :::::  :::::.:.: .: .:::::.:.::..::::::::::.::::.:::
SWALL: AEIDDAFRWSEENRNLQRKAEIVLQYYRGDEPLKRKVASTLLESFLFYSGFYLPMYWSSR
              130       140       150       160       170       180

         180       190       200       210       220       230     
/data/ GKLTNTADLIRLIIRDEAVHGYYIGYKYQIALQKLSAIEREELKLFALDLLMELYDNEIR
       .:::::::.::::::::::::::::::.: .:  .. . : ::: .. .::.::::::..
SWALL: AKLTNTADMIRLIIRDEAVHGYYIGYKFQRGLALVDDVTRAELKDYTYELLFELYDNEVE
              190       200       210       220       230       240

         240       250       260       270       280       290     
/data/ YTEALYAETGWVNDVKAFLCYNANKALMNLGYEALFPPEMADVNPAILAALSPNADENHD
       ::. :: :.: ..::: :: ::::::::::::::::: . .:::::::.:::::::::::
SWALL: YTQDLYDEVGLTEDVKKFLRYNANKALMNLGYEALFPRDETDVNPAILSALSPNADENHD
              250       260       270       280       290       300

         300       310         
/data/ FFSGSGSSYVMGKTVETEDEDWNF
       ::::::::::.::.: :::.::.:
SWALL: FFSGSGSSYVIGKAVVTEDDDWDF
              310       320    

>>SWALL:Q50549 Q50549 RIBONUCLEOTIDE REDUCTASE R2-2 SMAL  (324 aa)
 initn: 1531 init1: 1531 opt: 1554 Z-score: 1853.8 expect() 4.6e-96
Smith-Waterman score: 1554;  71.924% identity in 317 aa overlap

                    10        20        30        40        50     
/data/      MKLSRISAINWNKIQDDKDLEVWNRLTSNFWLPEKVPLSNDIPAWQTLSAAEQQL
              ..:.::::::..::.:: :::.:::.:::::::::.:::::.: ::.:.:.::
SWALL: MTGNAKLIDRVSAINWNRLQDEKDAEVWDRLTGNFWLPEKVPVSNDIPSWGTLTAGEKQL
               10        20        30        40        50        60

          60        70        80        90       100       110     
/data/ TIRVFTGLTLLDTIQNIAGAPSLMADAITPHEEAVLSNISFMEAVHARSYSSIFSTLCQT
       :.:::::::.:::::. .:: ::. ::.::::::::.::.:::.:::.:::.::::::.:
SWALL: TMRVFTGLTMLDTIQGTVGAVSLIPDALTPHEEAVLTNIAFMESVHAKSYSQIFSTLCST
               70        80        90       100       110       120

         120       130       140       150       160       170     
/data/ KEVDAAYAWSEENPPLQRKAQIILAHYVSDEPLKKKIASVFLESFLFYSGFWLPMYFSSR
        :.: :. :::::  :::::.:.: .: .:::::.:.::..::::::::::.::::.:::
SWALL: AEIDDAFRWSEENRNLQRKAEIVLQYYRGDEPLKRKVASTLLESFLFYSGFYLPMYWSSR
              130       140       150       160       170       180

         180       190       200       210       220       230     
/data/ GKLTNTADLIRLIIRDEAVHGYYIGYKYQIALQKLSAIEREELKLFALDLLMELYDNEIR
       .:::::::.::::::::::::::::::.: .:  .. . : ::: .. .::.::::::..
SWALL: AKLTNTADMIRLIIRDEAVHGYYIGYKFQRGLALVDDVTRAELKDYTYELLFELYDNEVE
              190       200       210       220       230       240

         240       250       260       270       280       290     
/data/ YTEALYAETGWVNDVKAFLCYNANKALMNLGYEALFPPEMADVNPAILAALSPNADENHD
       ::. :: :.: ..::: :: ::::::::::::::::: . .:::::::.:::::::::::
SWALL: YTQDLYDEVGLTEDVKKFLRYNANKALMNLGYEALFPRDETDVNPAILSALSPNADENHD
              250       260       270       280       290       300

         300       310         
/data/ FFSGSGSSYVMGKTVETEDEDWNF
       ::::::::::.::.: :::.::.:
SWALL: FFSGSGSSYVIGKAVVTEDDDWDF
              310       320    

>>SWALL:RIR2_MYCTU Q10840 RIBONUCLEOSIDE-DIPHOSPHATE RED  (322 aa)
 initn: 1382 init1: 1382 opt: 1402 Z-score: 1673.2 expect() 5.3e-86
Smith-Waterman score: 1402;  66.032% identity in 315 aa overlap

                  10        20        30        40        50       
/data/    MKLSRISAINWNKIQDDKDLEVWNRLTSNFWLPEKVPLSNDIPAWQTLSAAEQQLTI
              :. :::::.. : :::.::.:::.:::::::.:::::. .:::::..::: ::
SWALL: MTGKLVERVHAINWNRLLDAKDLQVWERLTGNFWLPEKIPLSNDLASWQTLSSTEQQTTI
               10        20        30        40        50        60

        60        70        80        90       100       110       
/data/ RVFTGLTLLDTIQNIAGAPSLMADAITPHEEAVLSNISFMEAVHARSYSSIFSTLCQTKE
       ::::::::::: :  .:: ... ::.::::::::.:..:::.:::.::::::::::.::.
SWALL: RVFTGLTLLDTAQATVGAVAMIDDAVTPHEEAVLTNMAFMESVHAKSYSSIFSTLCSTKQ
               70        80        90       100       110       120

       120       130       140       150       160       170       
/data/ VDAAYAWSEENPPLQRKAQIILAHYVSDEPLKKKIASVFLESFLFYSGFWLPMYFSSRGK
       .: :. :::.:: ::::::::. .: .:. ::.: .::.::::::::::.::::.:::::
SWALL: IDDAFDWSEQNPYLQRKAQIIVDYYRGDDALKRKASSVMLESFLFYSGFYLPMYWSSRGK
              130       140       150       160       170       180

       180       190       200       210       220       230       
/data/ LTNTADLIRLIIRDEAVHGYYIGYKYQIALQKLSAIEREELKLFALDLLMELYDNEIRYT
       ::::::::::::::::::::::::: : .:  :.  :: . . .. .::  :: ::: :.
SWALL: LTNTADLIRLIIRDEAVHGYYIGYKCQRGLADLTDAERADHREYTCELLHTLYANEIDYA
              190       200       210       220       230       240

       240       250       260       270       280       290       
/data/ EALYAETGWVNDVKAFLCYNANKALMNLGYEALFPPEMADVNPAILAALSPNADENHDFF
       . :: : ::..::  .. ::::::: ::::.  :  .  .::::. :::.:.: ::::::
SWALL: HDLYDELGWTDDVLPYMRYNANKALANLGYQPAFDRDTCQVNPAVRAALDPGAGENHDFF
              250       260       270       280       290       300

       300       310         
/data/ SGSGSSYVMGKTVETEDEDWNF
       ::::::::::    : : ::.:
SWALL: SGSGSSYVMGTHQPTTDTDWDF
              310       320  

>>SWALL:Q50548 Q50548 RIBONUCLEOTIDE REDUCTASE R2-1 SMAL  (321 aa)
 initn: 1333 init1: 683 opt: 1373 Z-score: 1638.7 expect() 4.4e-84
Smith-Waterman score: 1373;  65.079% identity in 315 aa overlap

                  10        20        30        40        50       
/data/    MKLSRISAINWNKIQDDKDLEVWNRLTSNFWLPEKVPLSNDIPAWQTLSAAEQQLTI
              :. :::::.. : :::.::.:::.:::::::.:::::. .:::::..::: ::
SWALL: MTGKLVERVHAINWNRLLDAKDLQVWERLTGNFWLPEKIPLSNDLASWQTLSSTEQQTTI
               10        20        30        40        50        60

        60        70        80        90       100       110       
/data/ RVFTGLTLLDTIQNIAGAPSLMADAITPHEEAVLSNISFMEAVHARSYSSIFSTLCQTKE
       ::::::::::: :  .:: ... ::.::::::::.:..:::.:::.::::::::::.::.
SWALL: RVFTGLTLLDTAQATVGAVAMIDDAVTPHEEAVLTNMAFMESVHAKSYSSIFSTLCSTKQ
               70        80        90       100       110       120

       120       130       140       150       160       170       
/data/ VDAAYAWSEENPPLQRKAQIILAHYVSDEPLKKKIASVFLESFLFYSGFWLPMYFSSRGK
       .: :. :::.:: ::::::::. .: .:.   .. .::.::::::::::.::::.:::::
SWALL: IDDAFDWSEQNPYLQRKAQIIVDYYRGDDAQAQR-SSVMLESFLFYSGFYLPMYWSSRGK
              130       140       150        160       170         

       180       190       200       210       220       230       
/data/ LTNTADLIRLIIRDEAVHGYYIGYKYQIALQKLSAIEREELKLFALDLLMELYDNEIRYT
       ::::::::::::::::::::::::: : .:  :.  :: . . .. .::  :: ::: :.
SWALL: LTNTADLIRLIIRDEAVHGYYIGYKCQRGLADLTDAERADHREYTCELLHTLYANEIDYA
     180       190       200       210       220       230         

       240       250       260       270       280       290       
/data/ EALYAETGWVNDVKAFLCYNANKALMNLGYEALFPPEMADVNPAILAALSPNADENHDFF
       . :: : ::..::  .. ::::::: ::::.  :  .  .::::. :::.:.: ::::::
SWALL: HDLYDELGWTDDVLPYMRYNANKALANLGYQPAFDRDTCQVNPAVRAALDPGAGENHDFF
     240       250       260       270       280       290         

       300       310         
/data/ SGSGSSYVMGKTVETEDEDWNF
       ::::::::::    : : ::.:
SWALL: SGSGSSYVMGTHQPTTDTDWDF
     300       310       320 

>>SWALL:RIR2_MYCPN P75461 RIBONUCLEOSIDE-DIPHOSPHATE RED  (339 aa)
 initn: 1096 init1: 1096 opt: 1112 Z-score: 1328.0 expect() 8.8e-67
Smith-Waterman score: 1112;  50.318% identity in 314 aa overlap

                                   10        20        30        40
/data/                     MKLSRISAINWNKIQDDKDLEVWNRLTSNFWLPEKVPLSN
                                . ..::: ..:.::::::::.:.:::::::.:.::
SWALL: MANTKKYFLESVSPLEYAQKKFQGNLRSVNWNLVDDEKDLEVWNRITQNFWLPEKIPVSN
               10        20        30        40        50        60

               50        60        70        80        90       100
/data/ DIPAWQTLSAAEQQLTIRVFTGLTLLDTIQNIAGAPSLMADAITPHEEAVLSNISFMEAV
       :::.:. ::   :.:  ..:::::::::::   :  . .  :.: ::... .:..:: .:
SWALL: DIPSWKQLSKEWQDLITKTFTGLTLLDTIQATIGDIKQIDYALTDHEQVIYANFAFMVGV
               70        80        90       100       110       120

              110       120       130       140       150       160
/data/ HARSYSSIFSTLCQTKEVDAAYAWSEENPPLQRKAQIILAHYVSDEPLKKKIASVFLESF
       :::::..:::::: ....  :. :  ..  ::..:. .. .:.. .:::.:.:.... .:
SWALL: HARSYGTIFSTLCTSEQITEAHEWVVKTESLQKRAKALIPYYTGKDPLKSKVAAALMPGF
              130       140       150       160       170       180

              170       180       190       200       210       220
/data/ LFYSGFWLPMYFSSRGKLTNTADLIRLIIRDEAVHGYYIGYKYQIALQKLSAIEREELKL
       :.:.::.::.:.::: .: ::.:.::::.::...:.:: :::.:  ..:.:  .. :.: 
SWALL: LLYGGFYLPFYLSSRKQLPNTSDIIRLILRDKVIHNYYSGYKFQRKVEKMSKEKQAEMKR
              190       200       210       220       230       240

              230       240       250       260       270       280
/data/ FALDLLMELYDNEIRYTEALYAETGWVNDVKAFLCYNANKALMNLGYEALFPPEMADVNP
       :..::..:: . :  : . ::   : :.:.  :  :::.: :.::::.. :  : . ..:
SWALL: FVFDLMYELIELEKAYLKELYEGFGIVEDAIKFSIYNAGKFLQNLGYDSPFTEEETRIKP
              250       260       270       280       290       300

              290       300       310         
/data/ AILAALSPNADENHDFFSGSGSSYVMGKTVETEDEDWNF
        :.: ::  ::::::::::.::::::: . ::::.::.:
SWALL: EIFAQLSARADENHDFFSGNGSSYVMGISEETEDKDWDF
              310       320       330         

>>SWALL:RIR2_MYCGE P47471 RIBONUCLEOSIDE-DIPHOSPHATE RED  (340 aa)
 initn: 1105 init1: 1105 opt: 1111 Z-score: 1326.8 expect() 1e-66
Smith-Waterman score: 1111;  50.000% identity in 314 aa overlap

                                    10        20        30         
/data/                      MKLSRISAINWNKIQDDKDLEVWNRLTSNFWLPEKVPLS
                                 . ..::: ..:.::::::::...:::::::.:.:
SWALL: MAANNKKYFLESFSPLGYVKNNFQGNLRSVNWNLVDDEKDLEVWNRIVQNFWLPEKIPVS
               10        20        30        40        50        60

      40        50        60        70        80        90         
/data/ NDIPAWQTLSAAEQQLTIRVFTGLTLLDTIQNIAGAPSLMADAITPHEEAVLSNISFMEA
       ::::.:. ::   :.:  ..:::::::::::   :    .  :.: ::... .:..:: .
SWALL: NDIPSWKKLSKDWQDLITKTFTGLTLLDTIQATIGDICQIDHALTDHEQVIYANFAFMVG
               70        80        90       100       110       120

     100       110       120       130       140       150         
/data/ VHARSYSSIFSTLCQTKEVDAAYAWSEENPPLQRKAQIILAHYVSDEPLKKKIASVFLES
       ::::::..:::::: .....::. :  ..  ::..:. .. .:....:::.:.:.... .
SWALL: VHARSYGTIFSTLCTSEQINAAHEWVVNTESLQKRAKALIPYYTGNDPLKSKVAAALMPG
              130       140       150       160       170       180

     160       170       180       190       200       210         
/data/ FLFYSGFWLPMYFSSRGKLTNTADLIRLIIRDEAVHGYYIGYKYQIALQKLSAIEREELK
       ::.:.::.::.:.::: .: ::.:.::::.::...:.:: :::::  :.::   ...:.:
SWALL: FLLYGGFYLPFYLSSRKQLPNTSDIIRLILRDKVIHNYYSGYKYQRKLEKLPLAKQKEMK
              190       200       210       220       230       240

     220       230       240       250       260       270         
/data/ LFALDLLMELYDNEIRYTEALYAETGWVNDVKAFLCYNANKALMNLGYEALFPPEMADVN
        :...:...: . :  : . ::   : :.:.  :  :::.: :.::::.. :    . ..
SWALL: AFVFELMYRLIELEKDYLKELYEGFGIVDDAIKFSVYNAGKFLQNLGYDSPFTAAETRIK
              250       260       270       280       290       300

     280       290       300       310         
/data/ PAILAALSPNADENHDFFSGSGSSYVMGKTVETEDEDWNF
       : :.: ::  ::::::::::.::::::: . ::.:.::::
SWALL: PEIFAQLSARADENHDFFSGNGSSYVMGVSEETNDDDWNF
              310       320       330       340

>>SWALL:RIR2_BACSU P50621 RIBONUCLEOSIDE-DIPHOSPHATE RED  (329 aa)
 initn: 764 init1: 423 opt: 868 Z-score: 1038.2 expect() 1.2e-50
Smith-Waterman score: 868;  43.558% identity in 326 aa overlap

                10        20        30        40        50         
/data/ MKLSRI-SAINWNKIQDDKDLEVWNRLTSNFWLPEKVPLSNDIPAWQTLSAAEQQLTIRV
         ...: .: ::.: .::     .:. ...:::::.. :..:. .:. :.  ::.  ..:
SWALL:   MTKIYDAANWSKHEDDFTQMFYNQNVKQFWLPEEIALNGDLLTWKYLGKNEQDTYMKV
                 10        20        30        40        50        

      60        70        80         90        100       110       
/data/ FTGLTLLDTIQNIAGAPSLMADAITPHE-EAVLSNISFME-AVHARSYSSIFSTLCQTKE
       ..::::::: :. .: : ..:. .  :. .:::. ...:: ::::.:::.:: ::  :. 
SWALL: LAGLTLLDTEQGNTGMP-IVAEHVDGHQRKAVLNFMAMMENAVHAKSYSNIFMTLAPTET
       60        70         80        90       100       110       

       120       130       140             150       160       170 
/data/ VDAAYAWSEENPPLQRKAQIILAHYVS----DEP--LKKKIASVFLESFLFYSGFWLPMY
       .. .. : ..:  ::.:::.:.. : .    ::   .:  .:::.::::::::::. :.:
SWALL: INEVFEWVKQNKYLQKKAQMIVGLYKAIQKDDEISLFKAMVASVYLESFLFYSGFYYPLY
       120       130       140       150       160       170       

             180       190       200       210       220       230 
/data/ FSSRGKLTNTADLIRLIIRDEAVHGYYIGYKYQIALQKLSAIEREELKLFALDLLMELYD
       : ..::: .....: ::.::::.:: :.:   :   .: .  .. ::. ::.::: .::.
SWALL: FYGQGKLMQSGEIINLILRDEAIHGVYVGLLAQEIYNKQTEEKKAELREFAIDLLNQLYE
       180       190       200       210       220       230       

             240       250       260       270       280       290 
/data/ NEIRYTEALYAETGWVNDVKAFLCYNANKALMNLGYEALFPPEMADVNPAILAALSPNAD
       ::..::: :: ..:  .::: :. :::::::::::..  :  :  :.:: .: .:. .. 
SWALL: NELEYTEDLYDQVGLSHDVKKFIRYNANKALMNLGFDPYFEEE--DINPIVLNGLNTKT-
       240       250       260       270       280         290     

             300       310                
/data/ ENHDFFSGSGSSYVMGKTVETEDEDWNF       
       ..::::: .:..:  . .   .:.:. :       
SWALL: KSHDFFSMKGNGYKKATVEPLKDDDFYFEDEKEQI
          300       310       320         

>>SWALL:O30601 O30601 YOJQ/S. 1/98                        (329 aa)
 initn: 742 init1: 411 opt: 837 Z-score: 1001.3 expect() 1.4e-48
Smith-Waterman score: 837;  43.252% identity in 326 aa overlap

                10        20        30        40        50         
/data/ MKLSRI-SAINWNKIQDDKDLEVWNRLTSNFWLPEKVPLSNDIPAWQTLSAAEQQLTIRV
         ...: .: ::.: .::     .:. ...:::::.. :..:. .:. :.  ::.  ..:
SWALL:   MTKIYDAANWSKHEDDFTQMFYNQNVKQFWLPEEIALNGDLLTWKYLGKNEQDTYMKV
                 10        20        30        40        50        

      60        70        80         90        100       110       
/data/ FTGLTLLDTIQNIAGAPSLMADAITPHE-EAVLSNISFME-AVHARSYSSIFSTLCQTKE
       ..::::::: :. .: : ..:. .  :. .:::. ...:: ::::.:::.:: ::  :..
SWALL: LAGLTLLDTEQGNTGMP-IVAEHVDGHQRKAVLNFMAMMENAVHAKSYSNIFLTLAPTEQ
       60        70         80        90       100       110       

       120       130       140             150       160       170 
/data/ VDAAYAWSEENPPLQRKAQIILAHYVS----DEP--LKKKIASVFLESFLFYSGFWLPMY
       .. .. : ..:  ::.::. :.. : .    ::   .:  .::::::::::::::. :.:
SWALL: INEVFEWVKNNRFLQKKARTIVSVYKTIKKNDEISLFKGMVASVFLESFLFYSGFYYPLY
       120       130       140       150       160       170       

             180       190       200       210       220       230 
/data/ FSSRGKLTNTADLIRLIIRDEAVHGYYIGYKYQIALQKLSAIEREELKLFALDLLMELYD
       : ..::: .....: :::::::.:: :.:   :   .: .  ...::  .::.::.:::.
SWALL: FYGQGKLMQSGEIINLIIRDEAIHGVYVGLLAQEIYKKQTPQKQKELYAWALNLLQELYE
       180       190       200       210       220       230       

             240       250       260       270       280       290 
/data/ NEIRYTEALYAETGWVNDVKAFLCYNANKALMNLGYEALFPPEMADVNPAILAALSPNAD
       ::..::: .: ..: . ::: :. ::::::: :::..  :  :  :::: .. .:. .. 
SWALL: NELEYTEDVYDQVGLAPDVKKFIRYNANKALNNLGFDHWFEEE--DVNPIVINGLNTKT-
       240       250       260       270       280         290     

             300       310                
/data/ ENHDFFSGSGSSYVMGKTVETEDEDWNF       
       ..::::: .:..:  . .   .: :. :       
SWALL: KSHDFFSTKGNGYKKATVEPLKDSDFIFTEKGCIQ
          300       310       320         

>>SWALL:E1185476 E1185476 YOSP PROTEIN. 1/98              (195 aa)
 initn: 467 init1: 213 opt: 493 Z-score: 596.0 expect() 5.3e-26
Smith-Waterman score: 493;  42.857% identity in 196 aa overlap

                10        20        30        40        50         
/data/ MKLSRI-SAINWNKIQDDKDLEVWNRLTSNFWLPEKVPLSNDIPAWQTLSAAEQQLTIRV
         ...: .: ::.: .::     .:. ...:::::.. :..:. .:. :.  ::.  ..:
SWALL:   MTKIYDAANWSKHEDDFTQMFYNQNVKQFWLPEEIALNGDLLTWKYLGKNEQDTYMKV
                 10        20        30        40        50        

      60        70        80         90        100       110       
/data/ FTGLTLLDTIQNIAGAPSLMADAITPHE-EAVLSNISFME-AVHARSYSSIFSTLCQTKE
       ..::::::: :. .: : ..:. .  :. .:::. ...:: ::::.:::.:: ::  :..
SWALL: LAGLTLLDTEQGNTGMP-IVAEHVDGHQRKAVLNFMAMMENAVHAKSYSNIFLTLAPTEQ
       60        70         80        90       100       110       

       120       130       140             150       160       170 
/data/ VDAAYAWSEENPPLQRKAQIILAHYVS----DEP--LKKKIASVFLESFLFYSGFWLPMY
       .. .. : ..:  ::.::. :.. : .    ::   .:  .::::::::::::::. :.:
SWALL: INEVFEWVKNNRFLQKKARTIVSVYKTIKKNDEISLFKGMVASVFLESFLFYSGFYYPLY
       120       130       140       150       160       170       

             180       190       200       210       220       230 
/data/ FSSRGKLTNTADLIRLIIRDEAVHGYYIGYKYQIALQKLSAIEREELKLFALDLLMELYD
       : ..::: .....: :::                                          
SWALL: FYGQGKLMQSGEIINLII                                          
       180       190                                               

>>SWALL:P74732 P74732 HYPOTHETICAL 41.6 KD PROTEIN. 3/98  (355 aa)
 initn: 215 init1: 102 opt: 306 Z-score: 369.5 expect() 2.2e-13
Smith-Waterman score: 306;  23.765% identity in 324 aa overlap

                                  10        20        30        40 
/data/                    MKLSRISAINWNKIQDDKDLEVWNRLTSNFWLPEKVPLSND
                                     : .. .  . .....  :::.:... ...:
SWALL: PVTPIFNPTGNDSVENRTIWFGNTTNLMQLNDVRYNWAVGLYQQMRENFWIPQRLDITQD
             20        30        40        50        60        70  

              50        60        70        80        90       100 
/data/ IPAWQTLSAAEQQLTIRVFTGLTLLDTIQNIAGAPSLMADAITPHEEAVLSNISFMEAVH
       .  . .:.  :.     ... ::.::..:.  . : : ... .:.    ...   .:..:
SWALL: VTDYWNLTNEERYAFDGILSYLTFLDSVQT-CNIPHLKSSVTAPEISLCMAEQISQEGMH
             80        90       100        110       120       130 

             110       120       130         140       150         
/data/ ARSYSSIFSTLCQTKEVDAAYAWSEENPPLQRKAQII--LAHYVSDEPLKKK-----IAS
        .::. .. :.  :.. : .: . . .  :... . :  : .   :.: ...     .:.
SWALL: NQSYQYMIETIIPTEKRDKVYEFWRTDRVLKERCEYIAMLYQKYVDHPTQENYFIALMAD
             140       150       160       170       180       190 

          160       170       180       190       200       210    
/data/ VFLESFLFYSGFWLPMYFSSRGKLTNTADLIRLIIRDEAVHGYYIGYKYQIALQKLSAIE
        .::.. ::.::   . ..::  . ..::....: :::  :            :::    
SWALL: YLLEGLYFYNGFIYFYNLASRMLMPGSADIFKMINRDELSHVRLY--------QKLIP--
             200       210       220       230               240   

          220         230           240          250       260     
/data/ REELKLF--ALDLLMELYDN----EIRYTEALYAET--GWV-NDVKAFLCYNANKALMNL
        : ...:  . : ..:..:.    : :.:. . ...  : . .... .  : ::. :  .
SWALL: -EAMQVFTHSTDQIYEMFDKAVEFECRWTNHIVGNNILGITESSTEQYTKYLANSRLRAI
              250       260       270       280       290       300

         270       280        290          300       310         
/data/ GYEALFPPEMADVNPAI-LAALSPNADENH---DFFSGSGSSYVMGKTVETEDEDWNF
       : . :.       .:   :  .: .  : :   .:: .. .::::.. :   ::    
SWALL: GLDPLYTDARYGKSPYTHLERFSDTKKEAHTKANFFEATVTSYVMSSGVSGWDEI   
              310       320       330       340       350        

>>SWALL:RIR2_HELPY P55983 RIBONUCLEOSIDE-DIPHOSPHATE RED  (341 aa)
 initn: 118 init1: 118 opt: 246 Z-score: 298.4 expect() 2e-09
Smith-Waterman score: 246;  23.853% identity in 327 aa overlap

                                     10        20        30        
/data/                       MKLSRISAINWNKIQDDKDLEVWNRLTSNFWLPEKVPL
                                   : .. :::. .   ..:. . .: :. :.: .
SWALL: MEVSRKKIYNPNSTESVNERKIFGGNPTSMFDLNKIKYQWADHLWKTMLANTWFAEEVSM
               10        20        30        40        50        60

       40        50        60        70        80        90        
/data/ SNDIPAWQTLSAAEQQLTIRVFTGLTLLDTIQNIAGAPSLMADAITPHEEAVLSNISFME
       ..:   .  ::: :.    :... : ..:..:      ..     .:. .  :   .. :
SWALL: NDDKRDYLKLSAEEKIGYDRALAQLIFMDSLQANNLIDNINPFITSPEINLCLVRQAYEE
               70        80        90       100       110       120

      100       110       120       130             140        150 
/data/ AVHARSYSSIFSTLCQTKEVDAAYAWSEENPPLQRK----AQII--LAHYVSDEP-LKKK
       :.:...:. .  ..  . : .    : ..   :. :    ::.   ::.  ..:  ::  
SWALL: ALHSHAYAVMVESISANTE-EIYDMWRNDMQ-LKSKNDYIAQVYMELAKNPTEENILKAL
              130        140       150        160       170        

             160       170       180       190       200       210 
/data/ IASVFLESFLFYSGFWLPMYFSSRGKLTNTADLIRLIIRDEAVHGYYIGYKYQIALQKLS
       .:. .::.. :::::   . ..  ::. ..:..::.: :::..:   : .. .:     .
SWALL: FANQILEGIYFYSGFSYFYTLARSGKMLGSAQMIRFIQRDEVTH--LILFQNMI-----N
      180       190       200       210       220         230      

             220          230       240               250       260
/data/ AIEREELKLFALDLLME---LYDNEIRYTEAL---YAETGWV-----NDVKAFLCYNANK
       :.. :.  ::. .:. :   .. . ..  :::   :   : .     . .. .. . :..
SWALL: ALRNERADLFTPQLINEVIGMFKKAVEI-EALWGDYITQGKILGLTSSLIEQYIQFLADS
             240       250        260       270       280       290

              270       280        290       300       310         
/data/ ALMNLGYEALFPPEMADVNPAI-LAALSPNADENHDFFSGSGSSYVMGKTVETEDEDWNF
        : ..:   ..  .    .:   . ..:   ..  .:: .  :.:. : .:  .:     
SWALL: RLSKVGIAKVYGVQ----HPIKWVESFSSFNEQRSNFFEARVSNYAKG-SVSFDDF    
              300           310       320       330        340     

>>SWALL:RIR2_VZVD P09247 RIBONUCLEOSIDE-DIPHOSPHATE REDU  (306 aa)
 initn: 130 init1:  47 opt: 225 Z-score: 274.2 expect() 4.4e-08
Smith-Waterman score: 225;  26.923% identity in 286 aa overlap

               10        20        30        40        50        60
/data/ MKLSRISAINWNKIQDDKDLEVWNRLTSNFWLPEKVPLSNDIPAWQTLSAAEQQLTIRVF
                                  :: ::     . .:    . :.  :  .   .:
SWALL:  MDQKDCSHFFYRPECPDINNLRALSISNRWLESDFIIEDDYQYLDCLTEDELIFYRFIF
                10        20        30        40        50         

               70         80        90       100       110         
/data/ TGLTLLDTIQNIA-GAPSLMADAITPHEEAVLSNISFMEAVHARSYSSIFSTLCQTKE-V
       : :.  : . :.  :. . . .    :.  . ..   .:.:::: ::.:   : .  : .
SWALL: TFLSAADDLVNVNLGSLTQLFSQKDIHHYYIEQEC--IEVVHARVYSQIQLMLFRGDESL
      60        70        80        90         100       110       

      120        130       140         150       160       170     
/data/ DAAYA-WSEENPPLQRKAQIILAHYVSDEP--LKKKIASVFLESFLFYSGFWLPMYFSSR
        . :.  . .:: .:.:.:  : . : :.:   .: :  ...:...: :.:    :. . 
SWALL: RVQYVNVTINNPSIQQKVQW-LEEKVRDNPSVAEKYILMILIEGIFFVSSFAAIAYLRNN
       120       130        140       150       160       170      

         180       190       200       210       220       230     
/data/ GKLTNTADLIRLIIRDEAVHGYYIGYKYQIALQKLSAIEREELKLFALDLLMELYDNEIR
       : .. : ..  :: ::::.:       :.  . .  :: : . .::.     :  . :  
SWALL: GLFVVTCQFNDLISRDEAIHTSASCCIYNNYVPEKPAITRIH-QLFS-----EAVEIECA
        180       190       200       210        220            230

         240         250       260       270         280       290 
/data/ YTEALYAETGWVN-D-VKAFLCYNANKALMNLGYEALF--PPEMADVNPAILAALSPNAD
       . ..   .:  :: : .  .. ..:.. :  ..   ::  ::  .:   :.. :     :
SWALL: FLKSHAPKTRLVNVDAITQYVKFSADRLLSAINVPKLFNTPPPDSDFPLAFMIA-----D
              240       250       260       270       280          

             300       310         
/data/ ENHDFFSGSGSSYVMGKTVETEDEDWNF
       .: .::   ..::.              
SWALL: KNTNFFERHSTSYAGTVINDL       
         290       300             

>>SWALL:RIR2_TOBAC P49730 RIBONUCLEOSIDE-DIPHOSPHATE RED  (329 aa)
 initn: 183 init1: 117 opt: 223 Z-score: 271.3 expect() 6.4e-08
Smith-Waterman score: 223;  24.621% identity in 264 aa overlap

                       10        20        30        40        50  
/data/         MKLSRISAINWNKIQDDKDLEVWNRLTSNFWLPEKVPLSNDIPAWQTLSAAE
                            ::  .  :....  ..::  :.: ::.:   :.::. .:
SWALL: MPLIPEEPLLASSPDRFCMFPIQYPQIWEMYKKALASFWTAEEVDLSSDTRHWETLTPGE
               10        20        30        40        50        60

             60          70        80        90       100          
/data/ QQLTIRVFTGLTLLDTI--QNIAGAPSLMADAITPHEEAVLSNISFMEAVHARSYSSIF-
       ...  .:.. ..  : :  .:.::   .: .. . . .:  .    .: .:.. :: .. 
SWALL: RHFITHVLAFFAASDGIVLENLAG--RFMKEVQVAEARAFYGFQIAIENIHSEMYSLLLE
               70        80          90       100       110        

     110       120       130       140       150        160        
/data/ STLCQTKEVDAAYAWSEENPPLQRKAQIILAHYVSDEPLKKK-IASVFLESFLFYSGFWL
       : . .. : .  .   : :: ...::.  :    ..: . .. .: . .:...: ..:  
SWALL: SYIKDSDEKSRLFRAVETNPCVEKKAKWALRWIDGSETFAERLVAFACVEGIFFSGSFCA
      120       130       140       150       160       170        

      170       180       190       200       210       220        
/data/ PMYFSSRGKLTNTADLIRLIIRDEAVHGYYIGYKYQIALQKLSAIEREELKLFALDLLME
        .....:: . . .   .:: :::..:  .    :..   ::.   .:..: .. : . :
SWALL: IFWLKKRGLMPGLTFSNELISRDEGLHCDFACLLYSLLRTKLT---EERVKGIVADAV-E
      180       190       200       210       220          230     

      230       240        250        260       270       280      
/data/ LYDNEIRYTEALY-AETGWVNDVKA-FLCYNANKALMNLGYEALFPPEMADVNPAILAAL
       .  . .   .::  : .:  .:. . .. . :.. :  :::. :.               
SWALL: IEREFV--CDALPCALVGMNGDLMSKYIEFVADRLLDALGYDKLYNAQNPFDWMELISLQ
          240         250       260       270       280       290  

        290       300       310             
/data/ SPNADENHDFFSGSGSSYVMGKTVETEDEDWNF    
                                            
SWALL: GKTNFFEKRVGEYQKASVMSSLNGNGATHEFKLDEDF
            300       310       320         

>>SWALL:RIR2_ARATH P50651 RIBONUCLEOSIDE-DIPHOSPHATE RED  (340 aa)
 initn:  42 init1:  42 opt: 207 Z-score: 252.1 expect() 7.6e-07
Smith-Waterman score: 207;  22.222% identity in 261 aa overlap

                         10        20        30        40        50
/data/           MKLSRISAINWNKIQDDKDLEVWNRLTSNFWLPEKVPLSNDIPAWQTLSA
                                     :....  ..::  :.: ::.:.  :..:. 
SWALL: DMEEGESEEPLLMAQNQRFTMFPIRYKSIWEMYKKAEASFWTAEEVDLSTDVQQWEALTD
               20        30        40        50        60        70

               60          70        80        90       100        
/data/ AEQQLTIRVFTGLTLLDTI--QNIAGAPSLMADAITPHEEAVLSNISFMEAVHARSYSSI
       .:...  .... ..  : :  .:.:    .. :. .:. .:  .    :: .:.. :: .
SWALL: SEKHFISHILAFFAASDGIVLENLA---RFLNDVQVPEARAFYGFQIAMENIHSEMYSLL
               80        90          100       110       120       

      110        120       130       140       150       160       
/data/ FSTLCQ-TKEVDAAYAWSEENPPLQRKAQIILAHYVSDEPLKKKIASVFLESFLFYSGFW
       . :. . .:: :  .   :  : ...::.  :    :   .  ....      .:.:: .
SWALL: LETFIKDSKEKDRLFNAIETIPCISKKAKWCLDWIQSPMSFAVRLVAFACAEGIFFSGSF
       130       140       150       160       170       180       

       170        180       190       200       210       220      
/data/ LPMYF-SSRGKLTNTADLIRLIIRDEAVHGYYIGYKYQIALQKLSAIEREELKLFALDLL
         ... ..:: . . .   .:: :::..:  .     .. ::    .:.      . ...
SWALL: CAIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLLISL-LQLHVPLEK------VYQIV
       190       200       210       220        230             240

        230        240         250       260       270       280   
/data/ MELYDNEIRYT-EALYAETGWVND--VKAFLCYNANKALMNLGYEALFPPEMADVNPAIL
        :  . : ... .::  .   .:.  .. .. . :.. :..:: :  .  :         
SWALL: HEAVEIETEFVCKALPCDLIGMNSNLMSQYIQFVADRLLVTLGCERTYKAENPFDWMEFI
              250       260       270       280       290       300

           290       300       310             
/data/ AALSPNADENHDFFSGSGSSYVMGKTVETEDEDWNF    
                                               
SWALL: SLQGKTNFFEKRVGEYQKASVMSNLQNGNQNYEFTTEEDF
              310       320       330       340

>>SWALL:RIR2_MESAU Q60561 RIBONUCLEOSIDE-DIPHOSPHATE RED  (386 aa)
 initn:  95 init1:  95 opt: 207 Z-score: 251.2 expect() 8.5e-07
Smith-Waterman score: 207;  22.006% identity in 309 aa overlap

                         10        20           30        40       
/data/           MKLSRISAINWNKIQDDKDLEVWN---RLTSNFWLPEKVPLSNDIPAWQT
                                     ..:.   .  ..::  :.: ::.::  :..
SWALL: SKVSTNPSVEDEPLLRENPRRFVVFPIEYHDIWKMYKKAEASFWTAEEVDLSKDIQHWEA
      60        70        80        90       100       110         

        50        60        70        80        90       100       
/data/ LSAAEQQLTIRVFTGLTLLDTIQNIAGAPSLMADAITPHEEAVLSNISFMEAVHARSYSS
       :.  :...  .:.. ..  : : :   .  .  .. . . .   .    :: .:.. :: 
SWALL: LKPDERHFISHVLAFFAASDGIVNENLVERFSQEVQVTEARCFYGFQIAMENIHSEMYSL
     120       130       140       150       160       170         

       110        120       130       140          150       160   
/data/ IFST-LCQTKEVDAAYAWSEENPPLQRKAQIILAHYVSDEPL---KKKIASVFLESFLFY
       ...: . ..:: .  .   :  : ...::.  : ....:.     .. .: . .:...: 
SWALL: LIDTYIKDSKEREYLFNAIETMPCVKKKADWAL-RWIGDKEATYGERVVAFAAVEGIFFS
     180       190       200       210        220       230        

           170       180       190       200       210       220   
/data/ SGFWLPMYFSSRGKLTNTADLIRLIIRDEAVHGYYIGYKYQIALQKLSAIEREELKLFAL
       ..:   .....:: . . .   .:: :::..:  .    ..  ..: :  . .:.   :.
SWALL: GSFASIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLMFKHLVHKPSEQRVQEIITNAV
      240       250       260       270       280       290        

           230       240         250       260       270       280 
/data/ DLLMELYDNEIRYTEALYAETGWVND--VKAFLCYNANKALMNLGYEALFPPEMADVNP-
        . .:.       :::: ..   .:   .: .. . :.. ...::.. .:  :    :: 
SWALL: RIEQEFL------TEALPVKLIGMNCTLMKQYIEFVADRLMLELGFNKIFKVE----NPF
      300             310       320       330       340            

              290       300       310         
/data/ AILAALSPNADENHDFFSGSGSSYVMGKTVETEDEDWNF
        ..  .: ..  :  : .  :    ::   ..   : .:
SWALL: DFMENISLEGKTNF-FEKRVGEYQRMGVMSNSFTLDADF
      350       360        370       380      

>>SWALL:P79733 P79733 RIBONUCLEOTIDE REDUCTASE PROTEIN R  (386 aa)
 initn:  99 init1:  99 opt: 201 Z-score: 244.1 expect() 2.1e-06
Smith-Waterman score: 201;  21.406% identity in 313 aa overlap

                                10        20        30        40   
/data/                  MKLSRISAINWNKIQDDKDLEVWNRLTSNFWLPEKVPLSNDIP
                                     ::     .....  ..::  :.: ::.:. 
SWALL: ESEGQSKAKKGAVEEEPLLKENPHRFVIFPIQYHDIWQMYKKAEASFWTAEEVDLSKDLQ
              60        70        80        90       100       110 

            50        60        70        80        90       100   
/data/ AWQTLSAAEQQLTIRVFTGLTLLDTIQNIAGAPSLMADAITPHEEAVLSNISFMEAVHAR
        :..:.  :. .  .:.. ..  : : :   .  .  .. . . .   .    :: .:..
SWALL: HWDSLKDEERYFISHVLAFFAASDGIVNENLVERFTQEVQVTEARCFYGFQIAMENIHSE
             120       130       140       150       160       170 

           110        120       130       140          150         
/data/ SYSSIFST-LCQTKEVDAAYAWSEENPPLQRKAQIILAHYVSDEPLK---KKIASVFLES
        :: ...: . ..:: .  .   :  : ...::.  : ....:.  .   . .: . .:.
SWALL: MYSLLIDTYIKDSKEREFLFNAIETMPCVKKKADWAL-NWIGDKNARYGERVVAFAAVEG
             180       190       200        210       220       230

     160       170       180       190       200       210         
/data/ FLFYSGFWLPMYFSSRGKLTNTADLIRLIIRDEAVHGYYIGYKYQIALQKLSAIEREELK
       ..: ..:   .....:: . . .   .:: :::..:  .    ..  ..: :    ... 
SWALL: IFFSGSFASIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLMFKHLINKPSEETVKKII
              240       250       260       270       280       290

     220       230       240        250        260       270       
/data/ LFALDLLMELYDNEIRYTEALYAET-GWVNDV-KAFLCYNANKALMNLGYEALFPPEMAD
       . :... .:.       :.:: ..  :   :. : .. . :.. :..::.. ..  :   
SWALL: MNAVEIEQEFL------TDALPVKLIGMNCDLMKQYIEFVADRLLLELGFDKVYRVE---
              300             310       320       330       340    

       280        290       300       310             
/data/ VNP-AILAALSPNADENHDFFSGSGSSYVMGKTVETEDEDWNF    
        ::  ..  .: ..  :  : .  :    ::    : :. ...    
SWALL: -NPFDFMENISLEGKTNF-FEKRVGEYQRMGVMSGTTDNTFTLDADF
              350        360       370       380      

>>SWALL:RIR2_HUMAN P31350 RIBONUCLEOSIDE-DIPHOSPHATE RED  (389 aa)
 initn:  95 init1:  95 opt: 198 Z-score: 240.4 expect() 3.4e-06
Smith-Waterman score: 198;  21.790% identity in 257 aa overlap

                         10        20        30        40        50
/data/           MKLSRISAINWNKIQDDKDLEVWNRLTSNFWLPEKVPLSNDIPAWQTLSA
                                     .....  ..::  :.: ::.::  :..:. 
SWALL: AAAPGVEDEPLLRENPRRFVIFPIEYHDIWQMYKKAEASFWTAEEVDLSKDIQHWESLKP
              70        80        90       100       110       120 

               60        70        80        90       100       110
/data/ AEQQLTIRVFTGLTLLDTIQNIAGAPSLMADAITPHEEAVLSNISFMEAVHARSYSSIFS
        :. .  .:.. ..  : : :   .  .  ..   . .   .    :: .:.. :: ...
SWALL: EERYFISHVLAFFAASDGIVNENLVERFSQEVQITEARCFYGFQIAMENIHSEMYSLLID
             130       140       150       160       170       180 

               120       130       140          150       160      
/data/ T-LCQTKEVDAAYAWSEENPPLQRKAQIILAHYVSDEPL---KKKIASVFLESFLFYSGF
       : . . :: .  .   :  : ...::.  : ....:.     .. .: . .:...: ..:
SWALL: TYIKDPKEREFLFNAIETMPCVKKKADWAL-RWIGDKEATYGERVVAFAAVEGIFFSGSF
             190       200       210        220       230       240

        170       180       190       200       210       220      
/data/ WLPMYFSSRGKLTNTADLIRLIIRDEAVHGYYIGYKYQIALQKLSAIEREELKLFALDLL
          .....:: . . .   .:: :::..:  .    ..  ..: :  . .:. . :. . 
SWALL: ASIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLMFKHLVHKPSEERVREIIINAVRIE
              250       260       270       280       290       300

        230       240         250       260       270       280    
/data/ MELYDNEIRYTEALYAETGWVND--VKAFLCYNANKALMNLGYEALFPPEMADVNPAILA
       .:.       :::: ..   .:   .: .. . :.. ...::.  .:             
SWALL: QEFL------TEALPVKLIGMNCTLMKQYIEFVADRLMLELGFSKVFRVENPFDFMENIS
                    310       320       330       340       350    

          290       300       310         
/data/ ALSPNADENHDFFSGSGSSYVMGKTVETEDEDWNF
                                          
SWALL: LEGKTNFFEKRVGEYQRMGVMSSPTENSFTLDADF
          360       370       380         

>>SWALL:G2828563 G2828563 RIBONUCLEOTIDE REDUCTASE M2 SU  (345 aa)
 initn:  41 init1:  41 opt: 196 Z-score: 238.9 expect() 4.1e-06
Smith-Waterman score: 196;  22.093% identity in 258 aa overlap

                         10        20           30        40       
/data/           MKLSRISAINWNKIQDDKDLEVWNRLT---SNFWLPEKVPLSNDIPAWQT
                                     ..: .     : .:  :.. :.::.  : :
SWALL: DKVAQGTNAEEEPLQQENPFRYVLFPIQYHDIWRKYKEQESCIWTVEEIDLGNDMKDWAT
            20        30        40        50        60        70   

        50        60          70        80        90       100     
/data/ LSAAEQQLTIRVFTGLTLLD--TIQNIAGAPSLMADAITPHEEAVLSNISFMEAVHARSY
       :. .:...  .:.. ..  :  .:.:.:    .:.:. .:. .:  .   .:: .:...:
SWALL: LNDGERHFIKHVLAFFAGSDGIVIENLA--QRFMSDVKVPEARAFYGFQLMMENIHSETY
            80        90       100         110       120       130 

         110        120       130       140       150       160    
/data/ SSIFST-LCQTKEVDAAYAWSEENPPLQRKAQIILAHYVSDEPLKKKIASVFLESFLFYS
       : ...: . ...:        .  : .:.::.  .    :.  ..... .      .:.:
SWALL: SVLLDTYITDSEEKLRLLHAIQTIPCIQKKAEWPVRWIGSSASFQQRLIGFAAVEGIFFS
             140       150       160       170       180       190 

          170        180       190       200       210       220   
/data/ GFWLPMYF-SSRGKLTNTADLIRLIIRDEAVHGYYIGYKYQIALQKLSAIEREELKLFAL
       : .  ... ..:: . . .   .:: :::..:  .    :.  ...   . ::..    :
SWALL: GSFCALFWLKKRGLMPGLTFSNELISRDEGLHTDFACLLYNSHIKH--KLPRERV----L
             200       210       220       230         240         

           230        240        250        260       270       280
/data/ DLLMELYDNEIRYT-EALYAET-GWVNDVKA-FLCYNANKALMNLGYEALFPPEMADVNP
       .....  . : ..  .:: ..  :   .. : .. . :.. :..:: :            
SWALL: EIIVDAVNIEREFICDALPVRLIGMNAELMAQYIEFVADRLLVSLGEEKHYRSTQPFDFM
         250       260       270       280       290       300     

              290       300       310          
/data/ AILAALSPNADENHDFFSGSGSSYVMGKTVETEDEDWNF 
                                               
SWALL: EMISLQGKTNFFEKRVGEYQKAGVMSTEGTSKKFSLSEDF
         310       320       330       340     

>>SWALL:RIR2_MOUSE P11157 RIBONUCLEOSIDE-DIPHOSPHATE RED  (390 aa)
 initn:  95 init1:  95 opt: 195 Z-score: 236.9 expect() 5.3e-06
Smith-Waterman score: 195;  21.401% identity in 257 aa overlap

                         10        20        30        40        50
/data/           MKLSRISAINWNKIQDDKDLEVWNRLTSNFWLPEKVPLSNDIPAWQTLSA
                                     .....  ..::  :.: ::.::  :..:. 
SWALL: PTNPSVEDEPLLRENPRRFVVFPIEYHDIWQMYKKAEASFWTAEEVDLSKDIQHWEALKP
             70        80        90       100       110       120  

               60        70        80        90       100       110
/data/ AEQQLTIRVFTGLTLLDTIQNIAGAPSLMADAITPHEEAVLSNISFMEAVHARSYSSIFS
        :...  .:.. ..  : : :   .  .  .. . . .   .    :: .:.. :: ...
SWALL: DERHFISHVLAFFAASDGIVNENLVERFSQEVQVTEARCFYGFQIAMENIHSEMYSLLID
            130       140       150       160       170       180  

               120       130       140          150       160      
/data/ T-LCQTKEVDAAYAWSEENPPLQRKAQIILAHYVSDEPL---KKKIASVFLESFLFYSGF
       : . . :: .  .   :  : ...::.  : ....:.     .. .: . .:...: ..:
SWALL: TYIKDPKEREYLFNAIETMPCVKKKADWAL-RWIGDKEATYGERVVAFAAVEGIFFSGSF
            190       200       210        220       230       240 

        170       180       190       200       210       220      
/data/ WLPMYFSSRGKLTNTADLIRLIIRDEAVHGYYIGYKYQIALQKLSAIEREELKLFALDLL
          .....:: . . .   .:: :::..:  .    ..  ..: .  . .:.   :. . 
SWALL: ASIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLMFKHLVHKPAEQRVREIITNAVRIE
             250       260       270       280       290       300 

        230       240         250       260       270       280    
/data/ MELYDNEIRYTEALYAETGWVND--VKAFLCYNANKALMNLGYEALFPPEMADVNPAILA
       .:.       :::: ..   .:   .: .. . :.. ...::.. .:             
SWALL: QEFL------TEALPVKLIGMNCTLMKQYIEFVADRLMLELGFNKIFRVENPFDFMENIS
                   310       320       330       340       350     

          290       300       310         
/data/ ALSPNADENHDFFSGSGSSYVMGKTVETEDEDWNF
                                          
SWALL: LEGKTNFFEKRVGEYQRMGVMSNSTENSFTLDADF
         360       370       380       390

>>SWALL:RIR2_DICDI P42521 RIBONUCLEOSIDE-DIPHOSPHATE RED  (338 aa)
 initn:  44 init1:  44 opt: 193 Z-score: 235.5 expect() 6.4e-06
Smith-Waterman score: 197;  21.683% identity in 309 aa overlap

                         10        20           30        40       
/data/           MKLSRISAINWNKIQDDKDLEVW---NRLTSNFWLPEKVPLSNDIPAWQ-
                                     ..:   ..  .. :. :.. :.::   :. 
SWALL: MEEINKKDTFIEPILKENKDRFVLFPIKYPDIWRMYKKALASHWVAEEIDLGNDNVDWEY
               10        20        30        40        50        60

         50        60        70        80        90       100      
/data/ TLSAAEQQLTIRVFTGLTLLDTIQNIAGAPSLMADAITPHEEAVLSNISFMEAVHARSYS
        :.  :...  .:.. ..  : : :   :  .:...  :. .   .    .: .:...::
SWALL: KLTDNERHFISHVLAFFAASDGIVNENLATRFMSEVQIPEARCFYGFQIAIENIHSETYS
               70        80        90       100       110       120

        110        120       130       140         150       160   
/data/ SIFSTLCQTKEV-DAAYAWSEENPPLQRKAQIILAHYV--SDEPLKKKIASVFLESFLFY
        .. :  . :.. :  .   :  : ...::.  : ...  ::   .. .: . .:...: 
SWALL: LLIETYIKDKQTKDKLFNAIETIPCIKKKAEWAL-RWINDSDSFAERLVAFAAVEGIFFS
              130       140       150        160       170         

           170       180       190       200       210       220   
/data/ SGFWLPMYFSSRGKLTNTADLIRLIIRDEAVHGYYIGYKYQIALQKLSAIEREELKLFAL
       ..:   .....:: . . .   .:: :::..:  .    :    .::.    ::    :.
SWALL: GSFCSIFWLKKRGLMQGLTFSNELISRDEGLHCDFACLLYTKLQRKLDPKVIEENDKSAV
     180       190       200       210       220       230         

           230       240         250       260       270       280 
/data/ DLLMELYDNEIRYTEALYAETGWVND--VKAFLCYNANKALMNLGYEALFPPEMADVNP-
       .   :.        :.: ..   .:.  .. .. . :.. ...:::. .:     . :: 
SWALL: ECEKEFI------CESLPVDLIGMNSRSMSQYIEFCADRLVVSLGYKKIF----NSSNPF
     240             250       260       270       280             

              290       300        310                    
/data/ AILAALSPNADENHDFFSGSGSSYV-MGKTVETEDEDWNF           
         .  .: .   :  :: :. . :.  : ... .... :            
SWALL: EWMEMISLQRKSN--FFEGKVAEYAKTGVAIQGNNQQKNNQSRTLVLDEDF
     290       300         310       320       330        

>>SWALL:RIR2_HSVBC Q01319 RIBONUCLEOSIDE-DIPHOSPHATE RED  (314 aa)
 initn:  90 init1:  56 opt: 192 Z-score: 234.8 expect() 6.9e-06
Smith-Waterman score: 195;  25.743% identity in 303 aa overlap

                    10        20         30        40        50    
/data/      MKLSRISAINWNKIQDDKDLEVWNRLT-SNFWLPEKVPLSNDIPAWQTLSAAEQQ
                              ::.    :. .: ::  . ::..:      ::.:: .
SWALL: MAEAADAATLTRKYKYFYETECPDLDHLRSLSVANRWLETEFPLADDAKDVARLSGAELE
               10        20        30        40        50        60

           60        70          80        90       100       110  
/data/ LTIRVFTGLTLLDTIQNIA-GAPS-LMADAITPHEEAVLSNISFMEAVHARSYSSIFSTL
       .   .:. :.  : . :.  :  : :...    :      .:   :.::.: ::.:   :
SWALL: FYRFLFAFLSAADDLVNVNLGDLSELFTQKDILHYYIEQESI---EVVHSRVYSAIQLLL
               70        80        90       100          110       

             120        130       140       150        160         
/data/ CQTKEVD-AAYAWSEE-NPPLQRKAQIILAHYVSDEPLKKK-IASVFLESFLFYSGFWLP
        ..  :  :.:. .   .: ..::.. .  . .. : . .: .  ...:...: :.:   
SWALL: FRNDAVARAGYVEGALGDPAVRRKVDWLERRVAAAESVAEKYVLMILIEGIFFSSSFAAI
       120       130       140       150       160       170       

     170       180       190                200       210       220
/data/ MYFSSRGKLTNTADLIRLIIRDEAVH---------GYYIGYKYQIALQKLSAIEREELKL
        :. ... .. : .   :: ::::::         .:  : .   :  ..  . ::  ::
SWALL: AYLRTHNLFVVTCQTNDLISRDEAVHTAASCCIFDNYLGGERPPPA--RIYELFREAWKL
       180       190       200       210       220         230     

              230       240       250       260       270          
/data/ FALDLLMELYDNEIRYTEALYAETGWVNDVKAFLCYNANKALMNLGYEALF--PPEMADV
        :      :.    : .. : .:.     ..:.. :.:.. :  .    ::  ::  .: 
SWALL: SA-----SLFGCAPRGSHILDVEA-----ISAYVEYSADRLLAAIQLPPLFGTPPPGTDF
              240       250            260       270       280     

      280       290       300       310         
/data/ NPAILAALSPNADENHDFFSGSGSSYVMGKTVETEDEDWNF
         :...:     ... .::   ...:.              
SWALL: PLALMTA-----EKHTNFFERRSTNYTGTVINDL       
         290            300       310           

>>SWALL:RIR2_CAEEL P42170 PROBABLE RIBONUCLEOSIDE-DIPHOS  (381 aa)
 initn: 107 init1:  72 opt: 189 Z-score: 229.9 expect() 1.3e-05
Smith-Waterman score: 189;  21.739% identity in 299 aa overlap

                            10        20           30        40    
/data/              MKLSRISAINWNKIQDDKDLEVWN---RLTSNFWLPEKVPLSNDIPA
                                     :  ..::   . ...::  :.: :..:.  
SWALL: ETNNESEVNELDADEPMLQDLDNRFVIFPLKHHDIWNFYKKAVASFWTVEEVDLGKDMND
        50        60        70        80        90       100       

           50        60        70        80        90        100   
/data/ WQTLSAAEQQLTIRVFTGLTLLDTIQNIAGAPSLMADAITPHEEAVLSNISF-MEAVHAR
       :. ... :: .  :... ..  : : :      . .. .   :   . .... .: .:..
SWALL: WEKMNGDEQYFISRILAFFAASDGIVNENLCERF-SNEVQVSEARFFYGFQIAIENIHSE
       110       120       130       140        150       160      

           110        120       130       140          150         
/data/ SYSSIFSTLCQTK-EVDAAYAWSEENPPLQRKAQIILAHYVSDEPL---KKKIASVFLES
        ::... :  . . : .. .   .:   ...::.  : ...::.     .. :: . .:.
SWALL: MYSKLIETYIRDETERNTLFNAVDEFEFIKKKADWAL-RWISDKKASFAERLIAFAAVEG
        170       180       190       200        210       220     

     160       170       180       190       200       210         
/data/ FLFYSGFWLPMYFSSRGKLTNTADLIRLIIRDEAVHGYYIGYKYQIALQKLSAIEREELK
       ..: ..:   .....:: . . .   .:: :::..:  .    :.   .::.     . .
SWALL: IFFSGSFASIFWLKKRGLMPGLTHSNELISRDEGLHRDFACLLYSKLQKKLT-----QQR
         230       240       250       260       270            280

     220       230        240         250       260       270      
/data/ LFALDLLMELYDNEIRY-TEALYAETGWVND--VKAFLCYNANKALMNLGYEALFPPEMA
       ..  :.. .    : .. :::: ..   .:   .. .. . :.. :..:: . :.  .  
SWALL: IY--DIIKDAVAIEQEFLTEALPVDMIGMNCRLMSQYIEFVADHLLVELGCDKLYKSK--
                290       300       310       320       330        

        280        290       300       310              
/data/ DVNP-AILAALSPNADENHDFFSGSGSSYVMGKTVETEDEDWNF     
         ::  ..  .: ..  :  ::    : :                    
SWALL: --NPFDFMENISIDGKTN--FFEKRVSEYQRPGVMVNEAERQFDLEADF
          340       350         360       370       380 

>>SWALL:Q98526 Q98526 RIBONUCLEOTIDE REDUCTASE. 3/98      (324 aa)
 initn:  56 init1:  56 opt: 186 Z-score: 227.4 expect() 1.8e-05
Smith-Waterman score: 186;  20.455% identity in 308 aa overlap

                      10        20        30        40         50  
/data/        MKLSRISAINWNKIQDDKDLEVWNRLTSNFWLPEKVPLSNDIPAW-QTLSAAE
                           ::     ..... ...::  :.:::. :.  : . :.  :
SWALL: MANQEPILADNGSRKFSAFPIQYPDMWDMYKKAVATFWTTEEVPLNADVVDWREKLNDDE
               10        20        30        40        50        60

             60        70        80        90       100       110  
/data/ QQLTIRVFTGLTLLDTIQNIAGAPSLMADAITPHEEAVLSNISFMEAVHARSYSSIFSTL
       ...  ...  ..  : :       .. ... .:. .   .  .: :..:...:. ....:
SWALL: RHFIKHILGFFAGSDGIVMENLQTNFSVEVTVPEARQFYAYQTFNESIHSEQYALLIDAL
               70        80        90       100       110       120

             120       130       140       150        160       170
/data/ -CQTKEVDAAYAWSEENPPLQRKAQIILAHYVSDEPLKKK-IASVFLESFLFYSGFWLPM
         . .: .  .   :. : .. ::.         . . .. .: : .:..:: ..:   .
SWALL: ISDEQERNELFDAIENIPAVHNKAKWAQKWLEPGKSFAERLVAWVCVEGILFSGSFCAIF
              130       140       150       160       170       180

              180       190       200       210       220       230
/data/ YFSSRGKLTNTADLIRLIIRDEAVHGYYIGYKYQIALQKLSAIEREELKLFALDLLMELY
       .. ..: . . .   ..: :::..:  .    :.   .::     : .:    ... :  
SWALL: WLRNKGVMPGLGLSNEFISRDEGLHQQFGELMYSKLQNKLPF---ETVK----QIITEAV
              190       200       210       220              230   

               240         250       260       270       280       
/data/ DNEIRYT-EALYAETGWVND--VKAFLCYNANKALMNLGYEALFPPEMADVNP-AILAAL
       .:: ..  .:.  .   .:   .  .. . :.. .. :::: ..  .    :: :..  .
SWALL: ENEKEFICDAIPCRLIGMNAELMGQYIEFVADRIFVALGYEKVYNSK----NPFAFMELI
           240       250       260       270       280             

        290       300       310             
/data/ SPNADENHDFFSGSGSSYVMGKTVETEDEDWNF    
       : ..  :  ::    :.:    ... ::.        
SWALL: SLQGKTN--FFEKRVSDYQRPGVMKPEDNIFAIDDDF
     290         300       310       320    



319 residues in 1 query   sequences
75633374 residues in 242566 library sequences
 Tcomplib (4 proc)[version 3.0t82 November 1, 1997]
 start: Mon Mar 16 14:20:20 1998 done: Mon Mar 16 14:21:56 1998
 Scan time: 36.370 Display time:  0.800

Function used was  FASTA 

 Introducció

Tema 2

 Tema 3

Tema 4

Tema5i6

 Tema 7

  Presentació

 Buscadors

  Truks :)

  Aprofitant...
 Gracies a Software